CA4 purified MaxPab mouse polyclonal antibody (B02P)
  • CA4 purified MaxPab mouse polyclonal antibody (B02P)

CA4 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00000762-B02P
CA4 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CA4 protein.
Información adicional
Size 50 ug
Gene Name CA4
Gene Alias CAIV|Car4|RP17
Gene Description carbonic anhydrase IV
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CA4 (NP_000708.1, 1 a.a. ~ 312 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 762

Enviar uma mensagem


CA4 purified MaxPab mouse polyclonal antibody (B02P)

CA4 purified MaxPab mouse polyclonal antibody (B02P)