CA3 purified MaxPab rabbit polyclonal antibody (D01P)
  • CA3 purified MaxPab rabbit polyclonal antibody (D01P)

CA3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000761-D01P
CA3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CA3 protein.
Información adicional
Size 100 ug
Gene Name CA3
Gene Alias CAIII|Car3
Gene Description carbonic anhydrase III, muscle specific
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CA3 (NP_005172.1, 1 a.a. ~ 260 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 761

Enviar uma mensagem


CA3 purified MaxPab rabbit polyclonal antibody (D01P)

CA3 purified MaxPab rabbit polyclonal antibody (D01P)