CA2 monoclonal antibody (M34), clone 5A8
  • CA2 monoclonal antibody (M34), clone 5A8

CA2 monoclonal antibody (M34), clone 5A8

Ref: AB-H00000760-M34
CA2 monoclonal antibody (M34), clone 5A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CA2.
Información adicional
Size 100 ug
Gene Name CA2
Gene Alias CA-II|CAII|Car2
Gene Description carbonic anhydrase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CA2 (NP_000058.1, 191 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 760
Clone Number 5A8
Iso type IgG1 Kappa

Enviar uma mensagem


CA2 monoclonal antibody (M34), clone 5A8

CA2 monoclonal antibody (M34), clone 5A8