CA2 monoclonal antibody (M10), clone 7C11
  • CA2 monoclonal antibody (M10), clone 7C11

CA2 monoclonal antibody (M10), clone 7C11

Ref: AB-H00000760-M10
CA2 monoclonal antibody (M10), clone 7C11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CA2.
Información adicional
Size 100 ug
Gene Name CA2
Gene Alias CA-II|CAII|Car2
Gene Description carbonic anhydrase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq WTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CA2 (NP_000058.1, 191 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 760
Clone Number 7C11
Iso type IgG1 Kappa

Enviar uma mensagem


CA2 monoclonal antibody (M10), clone 7C11

CA2 monoclonal antibody (M10), clone 7C11