Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
C21orf2 MaxPab mouse polyclonal antibody (B01)
Abnova
C21orf2 MaxPab mouse polyclonal antibody (B01)
Ref: AB-H00000755-B01
C21orf2 MaxPab mouse polyclonal antibody (B01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human C21orf2 protein.
Información adicional
Size
50 uL
Gene Name
C21orf2
Gene Alias
A2|YF5
Gene Description
chromosome 21 open reading frame 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MKLTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQEMPSLEVITLSVNSISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPCCGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRALSEGEEITAAPEREGTGHGGPKLCCTLSSLSSAAETGRDPLDSEEEATGAQDERGLKPPSRGQFPSLSARDASSSHRGRVSGGPLGAAAASAHCTHCTETVGREHGASQGPVGREHGASQG
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
C21orf2 (AAH31300.1, 1 a.a. ~ 375 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
755
Enviar uma mensagem
C21orf2 MaxPab mouse polyclonal antibody (B01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*