MRPL49 polyclonal antibody (A01)
  • MRPL49 polyclonal antibody (A01)

MRPL49 polyclonal antibody (A01)

Ref: AB-H00000740-A01
MRPL49 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MRPL49.
Información adicional
Size 50 uL
Gene Name MRPL49
Gene Alias C11orf4|L49mt|MGC10656|NOF|NOF1
Gene Description mitochondrial ribosomal protein L49
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWALQKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MRPL49 (NP_004918, 67 a.a. ~ 166 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 740

Enviar uma mensagem


MRPL49 polyclonal antibody (A01)

MRPL49 polyclonal antibody (A01)