Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
OSGIN2 monoclonal antibody (M02), clone 3E11
Abnova
OSGIN2 monoclonal antibody (M02), clone 3E11
Ref: AB-H00000734-M02
OSGIN2 monoclonal antibody (M02), clone 3E11
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant OSGIN2.
Información adicional
Size
100 ug
Gene Name
OSGIN2
Gene Alias
C8orf1|hT41
Gene Description
oxidative stress induced growth inhibitor family member 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA
Immunogen Prot. Seq
SGLKKIFKLSAAVVLIGSHPNLSFLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALGVTRCLATRQKKKHLFVERGGGDGIA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
OSGIN2 (AAH31054, 398 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
734
Clone Number
3E11
Iso type
IgG2a Kappa
Enviar uma mensagem
OSGIN2 monoclonal antibody (M02), clone 3E11
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*