Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
C3 monoclonal antibody (M11), clone X1
Abnova
C3 monoclonal antibody (M11), clone X1
Ref: AB-H00000718-M11
C3 monoclonal antibody (M11), clone X1
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant C3.
Información adicional
Size
100 ug
Gene Name
C3
Gene Alias
ARMD9|ASP|CPAMD1
Gene Description
complement component 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
718
Clone Number
X1
Iso type
IgG2a Kappa
Enviar uma mensagem
C3 monoclonal antibody (M11), clone X1
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*