C2 monoclonal antibody (M07), clone 7G1
  • C2 monoclonal antibody (M07), clone 7G1

C2 monoclonal antibody (M07), clone 7G1

Ref: AB-H00000717-M07
C2 monoclonal antibody (M07), clone 7G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant C2.
Información adicional
Size 100 ug
Gene Name C2
Gene Alias CO2|DKFZp779M0311
Gene Description complement component 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq APSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C2 (NP_000054.2, 21 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 717
Clone Number 7G1
Iso type IgG2b Kappa

Enviar uma mensagem


C2 monoclonal antibody (M07), clone 7G1

C2 monoclonal antibody (M07), clone 7G1