Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
C2 purified MaxPab mouse polyclonal antibody (B02P)
Abnova
C2 purified MaxPab mouse polyclonal antibody (B02P)
Ref: AB-H00000717-B02P
C2 purified MaxPab mouse polyclonal antibody (B02P)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human C2 protein.
Información adicional
Size
50 ug
Gene Name
C2
Gene Alias
CO2|DKFZp779M0311
Gene Description
complement component 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRSGHLNL
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
C2 (NP_000054.2, 1 a.a. ~ 752 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
717
Enviar uma mensagem
C2 purified MaxPab mouse polyclonal antibody (B02P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*