Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BZRP monoclonal antibody (M01), clone 3D8-B2
Abnova
BZRP monoclonal antibody (M01), clone 3D8-B2
Ref: AB-H00000706-M01
BZRP monoclonal antibody (M01), clone 3D8-B2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant BZRP.
Información adicional
Size
100 ug
Gene Name
TSPO
Gene Alias
BZRP|DBI|IBP|MBR|PBR|PKBS|PTBR|mDRC|pk18
Gene Description
translocator protein (18kDa)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BZRP (AAH01110.1, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
706
Clone Number
3D8-B2
Iso type
IgG1 kappa
Enviar uma mensagem
BZRP monoclonal antibody (M01), clone 3D8-B2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*