TSPO purified MaxPab rabbit polyclonal antibody (D01P)
  • TSPO purified MaxPab rabbit polyclonal antibody (D01P)

TSPO purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000706-D01P
TSPO purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TSPO protein.
Información adicional
Size 100 ug
Gene Name TSPO
Gene Alias BZRP|DBI|IBP|MBR|PBR|PKBS|PTBR|mDRC|pk18
Gene Description translocator protein (18kDa)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 706

Enviar uma mensagem


TSPO purified MaxPab rabbit polyclonal antibody (D01P)

TSPO purified MaxPab rabbit polyclonal antibody (D01P)