KLF5 polyclonal antibody (A01)
  • KLF5 polyclonal antibody (A01)

KLF5 polyclonal antibody (A01)

Ref: AB-H00000688-A01
KLF5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KLF5.
Información adicional
Size 50 uL
Gene Name KLF5
Gene Alias BTEB2|CKLF|IKLF
Gene Description Kruppel-like factor 5 (intestinal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF5 (NP_001721, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 688

Enviar uma mensagem


KLF5 polyclonal antibody (A01)

KLF5 polyclonal antibody (A01)