BTD purified MaxPab rabbit polyclonal antibody (D01P)
  • BTD purified MaxPab rabbit polyclonal antibody (D01P)

BTD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000686-D01P
BTD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BTD protein.
Información adicional
Size 100 ug
Gene Name BTD
Gene Alias -
Gene Description biotinidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTD (NP_000051.1, 1 a.a. ~ 543 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 686

Enviar uma mensagem


BTD purified MaxPab rabbit polyclonal antibody (D01P)

BTD purified MaxPab rabbit polyclonal antibody (D01P)