BRAF monoclonal antibody (M10), clone 1H7
  • BRAF monoclonal antibody (M10), clone 1H7

BRAF monoclonal antibody (M10), clone 1H7

Ref: AB-H00000673-M10
BRAF monoclonal antibody (M10), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BRAF.
Información adicional
Size 100 ug
Gene Name BRAF
Gene Alias B-RAF1|BRAF1|FLJ95109|MGC126806|MGC138284|RAFB1
Gene Description v-raf murine sarcoma viral oncogene homolog B1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq FQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BRAF (NP_004324, 138 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 673
Clone Number 1H7
Iso type IgG2a Kappa

Enviar uma mensagem


BRAF monoclonal antibody (M10), clone 1H7

BRAF monoclonal antibody (M10), clone 1H7