Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BRAF monoclonal antibody (M01), clone 3C6
Abnova
BRAF monoclonal antibody (M01), clone 3C6
Ref: AB-H00000673-M01
BRAF monoclonal antibody (M01), clone 3C6
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant BRAF.
Información adicional
Size
50 ug
Gene Name
BRAF
Gene Alias
B-RAF1|BRAF1|FLJ95109|MGC126806|MGC138284|RAFB1
Gene Description
v-raf murine sarcoma viral oncogene homolog B1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq
FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BRAF (NP_004324, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
673
Clone Number
3C6
Iso type
IgG1 Kappa
Enviar uma mensagem
BRAF monoclonal antibody (M01), clone 3C6
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*