Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00000662-D01P
BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human BNIP1 protein.
Información adicional
Size
100 ug
Gene Name
BNIP1
Gene Alias
NIP1|SEC20|TRG-8
Gene Description
BCL2/adenovirus E1B 19kDa interacting protein 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALRLFLATVLYIVKKRLFPFL
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
BNIP1 (NP_053581.1, 1 a.a. ~ 194 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
662
Enviar uma mensagem
BNIP1 purified MaxPab rabbit polyclonal antibody (D01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*