Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BMPR1A polyclonal antibody (A03)
Abnova
BMPR1A polyclonal antibody (A03)
Ref: AB-H00000657-A03
BMPR1A polyclonal antibody (A03)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length recombinant BMPR1A.
Información adicional
Size
50 uL
Gene Name
BMPR1A
Gene Alias
10q23del|ACVRLK3|ALK3|CD292
Gene Description
bone morphogenetic protein receptor, type IA
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSGFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLVDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRG
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BMPR1A (AAH28383, 1 a.a. ~ 532 a.a) full-length recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
657
Enviar uma mensagem
BMPR1A polyclonal antibody (A03)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*