BMP7 polyclonal antibody (A01)
  • BMP7 polyclonal antibody (A01)

BMP7 polyclonal antibody (A01)

Ref: AB-H00000655-A01
BMP7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant BMP7.
Información adicional
Size 50 uL
Gene Name BMP7
Gene Alias OP-1
Gene Description bone morphogenetic protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BMP7 (AAH08584, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 655

Enviar uma mensagem


BMP7 polyclonal antibody (A01)

BMP7 polyclonal antibody (A01)