Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BMP5 monoclonal antibody (M88), clone 4A7
Abnova
BMP5 monoclonal antibody (M88), clone 4A7
Ref: AB-H00000653-M88
BMP5 monoclonal antibody (M88), clone 4A7
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant BMP5.
Información adicional
Size
100 ug
Gene Name
BMP5
Gene Alias
MGC34244
Gene Description
bone morphogenetic protein 5
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
S-ELISA,ELISA
Immunogen Prot. Seq
NQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BMP5 (NP_066551.1, 323 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
653
Clone Number
4A7
Iso type
IgG2a Kappa
Enviar uma mensagem
BMP5 monoclonal antibody (M88), clone 4A7
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*