BMP5 monoclonal antibody (M07), clone 4B3
  • BMP5 monoclonal antibody (M07), clone 4B3

BMP5 monoclonal antibody (M07), clone 4B3

Ref: AB-H00000653-M07
BMP5 monoclonal antibody (M07), clone 4B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BMP5.
Información adicional
Size 100 ug
Gene Name BMP5
Gene Alias MGC34244
Gene Description bone morphogenetic protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq VGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVIL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BMP5 (NP_066551.1, 341 a.a. ~ 440 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 653
Clone Number 4B3
Iso type IgG2a Kappa

Enviar uma mensagem


BMP5 monoclonal antibody (M07), clone 4B3

BMP5 monoclonal antibody (M07), clone 4B3