Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BMP2 purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
BMP2 purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00000650-D01P
BMP2 purified MaxPab rabbit polyclonal antibody (D01P)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human BMP2 protein.
Información adicional
Size
100 ug
Gene Name
BMP2
Gene Alias
BMP2A
Gene Description
bone morphogenetic protein 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Tr
Immunogen Prot. Seq
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEH
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
BMP2 (AAI48690.1, 1 a.a. ~ 396 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
650
Enviar uma mensagem
BMP2 purified MaxPab rabbit polyclonal antibody (D01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*