BLVRB monoclonal antibody (M09), clone 2F4
  • BLVRB monoclonal antibody (M09), clone 2F4

BLVRB monoclonal antibody (M09), clone 2F4

Ref: AB-H00000645-M09
BLVRB monoclonal antibody (M09), clone 2F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant BLVRB.
Información adicional
Size 100 ug
Gene Name BLVRB
Gene Alias BVRB|FLR|MGC117413|SDR43U1
Gene Description biliverdin reductase B (flavin reductase (NADPH))
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BLVRB (NP_000704, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 645
Clone Number 2F4
Iso type IgG2a Kappa

Enviar uma mensagem


BLVRB monoclonal antibody (M09), clone 2F4

BLVRB monoclonal antibody (M09), clone 2F4