Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BLMH monoclonal antibody (M02), clone 4A2
Abnova
BLMH monoclonal antibody (M02), clone 4A2
Ref: AB-H00000642-M02
BLMH monoclonal antibody (M02), clone 4A2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant BLMH.
Información adicional
Size
100 ug
Gene Name
BLMH
Gene Alias
BH|BMH
Gene Description
bleomycin hydrolase
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BLMH (NP_000377, 356 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
642
Clone Number
4A2
Iso type
IgG2a Kappa
Enviar uma mensagem
BLMH monoclonal antibody (M02), clone 4A2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*