BLM polyclonal antibody (A01)
  • BLM polyclonal antibody (A01)

BLM polyclonal antibody (A01)

Ref: AB-H00000641-A01
BLM polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BLM.
Información adicional
Size 50 uL
Gene Name BLM
Gene Alias BS|MGC126616|MGC131618|MGC131620|RECQ2|RECQL2|RECQL3
Gene Description Bloom syndrome
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BLM (NP_000048, 1196 a.a. ~ 1295 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 641

Enviar uma mensagem


BLM polyclonal antibody (A01)

BLM polyclonal antibody (A01)