Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BLK monoclonal antibody (M01), clone 3E5-3A8
Abnova
BLK monoclonal antibody (M01), clone 3E5-3A8
Ref: AB-H00000640-M01
BLK monoclonal antibody (M01), clone 3E5-3A8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant BLK.
Información adicional
Size
100 ug
Gene Name
BLK
Gene Alias
MGC10442
Gene Description
B lymphoid tyrosine kinase
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSGQFGEV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BLK (AAH07371, 1 a.a. ~ 505 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
640
Clone Number
3E5-3A8
Iso type
IgG1 kappa
Enviar uma mensagem
BLK monoclonal antibody (M01), clone 3E5-3A8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*