Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
PRDM1 monoclonal antibody (M08), clone 1F2
Abnova
PRDM1 monoclonal antibody (M08), clone 1F2
Ref: AB-H00000639-M08
PRDM1 monoclonal antibody (M08), clone 1F2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full-length recombinant PRDM1.
Información adicional
Size
100 ug
Gene Name
PRDM1
Gene Alias
BLIMP1|MGC118922|MGC118923|MGC118924|MGC118925|PRDI-BF1
Gene Description
PR domain containing 1, with ZNF domain
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,ELISA
Immunogen Prot. Seq
HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHV
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
PRDM1 (NP_001189, 422 a.a. ~ 493 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
639
Clone Number
1F2
Iso type
IgG2a Kappa
Enviar uma mensagem
PRDM1 monoclonal antibody (M08), clone 1F2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*