PRDM1 monoclonal antibody (M08), clone 1F2
  • PRDM1 monoclonal antibody (M08), clone 1F2

PRDM1 monoclonal antibody (M08), clone 1F2

Ref: AB-H00000639-M08
PRDM1 monoclonal antibody (M08), clone 1F2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PRDM1.
Información adicional
Size 100 ug
Gene Name PRDM1
Gene Alias BLIMP1|MGC118922|MGC118923|MGC118924|MGC118925|PRDI-BF1
Gene Description PR domain containing 1, with ZNF domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,ELISA
Immunogen Prot. Seq HPMLNPTSLPSSLPSDGARRLLQPEHPREVLVPAPHSAFSFTGAAASMKDKACSPTSGSPTAGTAATAEHV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDM1 (NP_001189, 422 a.a. ~ 493 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 639
Clone Number 1F2
Iso type IgG2a Kappa

Enviar uma mensagem


PRDM1 monoclonal antibody (M08), clone 1F2

PRDM1 monoclonal antibody (M08), clone 1F2