PRDM1 polyclonal antibody (A01)
  • PRDM1 polyclonal antibody (A01)

PRDM1 polyclonal antibody (A01)

Ref: AB-H00000639-A01
PRDM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRDM1.
Información adicional
Size 50 uL
Gene Name PRDM1
Gene Alias BLIMP1|MGC118922|MGC118923|MGC118924|MGC118925|PRDI-BF1
Gene Description PR domain containing 1, with ZNF domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDM1 (NP_001189, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 639

Enviar uma mensagem


PRDM1 polyclonal antibody (A01)

PRDM1 polyclonal antibody (A01)