BID purified MaxPab rabbit polyclonal antibody (D01P)
  • BID purified MaxPab rabbit polyclonal antibody (D01P)

BID purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000637-D01P
BID purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BID protein.
Información adicional
Size 100 ug
Gene Name BID
Gene Alias FP497|MGC15319|MGC42355
Gene Description BH3 interacting domain death agonist
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BID (NP_001187.1, 1 a.a. ~ 195 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 637

Enviar uma mensagem


BID purified MaxPab rabbit polyclonal antibody (D01P)

BID purified MaxPab rabbit polyclonal antibody (D01P)