AB-H00000627-M02
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 100 ug |
Gene Name | BDNF |
Gene Alias | MGC34632 |
Gene Description | brain-derived neurotrophic factor |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA,IF |
Immunogen Prot. Seq | MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | BDNF (AAH29795, 1 a.a. ~ 247 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 627 |
Clone Number | 1B10 |
Iso type | IgG2a Kappa |