BDKRB2 polyclonal antibody (A01)
  • BDKRB2 polyclonal antibody (A01)

BDKRB2 polyclonal antibody (A01)

Ref: AB-H00000624-A01
BDKRB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BDKRB2.
Información adicional
Size 50 uL
Gene Name BDKRB2
Gene Alias B2R|BK-2|BK2|BKR2|BRB2|DKFZp686O088
Gene Description bradykinin receptor B2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BDKRB2 (NP_000614, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 624

Enviar uma mensagem


BDKRB2 polyclonal antibody (A01)

BDKRB2 polyclonal antibody (A01)