Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BCR monoclonal antibody (M01), clone 2E5
Abnova
BCR monoclonal antibody (M01), clone 2E5
Ref: AB-H00000613-M01
BCR monoclonal antibody (M01), clone 2E5
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant BCR.
Información adicional
Size
100 ug
Gene Name
BCR
Gene Alias
ALL|BCR-ABL1|BCR1|CML|D22S11|D22S662|FLJ16453|PHL
Gene Description
breakpoint cluster region
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,S-ELISA,ELISA,PLA-Ce,IF
Immunogen Prot. Seq
FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
BCR (NP_004318.3, 182 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
613
Clone Number
2E5
Iso type
IgG2a Kappa
Enviar uma mensagem
BCR monoclonal antibody (M01), clone 2E5
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*