Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
BCKDHA purified MaxPab mouse polyclonal antibody (B01P)
Abnova
BCKDHA purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00000593-B01P
BCKDHA purified MaxPab mouse polyclonal antibody (B01P)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human BCKDHA protein.
Información adicional
Size
50 ug
Gene Name
BCKDHA
Gene Alias
BCKDE1A|FLJ45695|MSU|MSUD1|OVD1A
Gene Description
branched chain keto acid dehydrogenase E1, alpha polypeptide
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MAVAIAAARVWRLNRGLSQAALLLLRQPGARGLARSHPPRQQQQFSSLDDKPQFPGASAEFIDKLEFIQPNVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILYESQRQGRISFYMTNYGEEGTHVGSAAALDNTDLVFGQYREAGVLMYRDYPLELFMAQCYGNISDLGKGRQMPVHYGCKERHFVTISSPLATQIPQAVGAAYAAKRANANRVVICYFGEGAASEGDAHAGFNFAAT
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
BCKDHA (NP_000700.1, 1 a.a. ~ 445 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
593
Enviar uma mensagem
BCKDHA purified MaxPab mouse polyclonal antibody (B01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*