B2M purified MaxPab rabbit polyclonal antibody (D01P)
  • B2M purified MaxPab rabbit polyclonal antibody (D01P)

B2M purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000567-D01P
B2M purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human B2M protein.
Información adicional
Size 100 ug
Gene Name B2M
Gene Alias -
Gene Description beta-2-microglobulin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen B2M (NP_004039.1, 1 a.a. ~ 119 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 567

Enviar uma mensagem


B2M purified MaxPab rabbit polyclonal antibody (D01P)

B2M purified MaxPab rabbit polyclonal antibody (D01P)