Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ATR polyclonal antibody (A01)
Abnova
ATR polyclonal antibody (A01)
Ref: AB-H00000545-A01
ATR polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant ATR.
Información adicional
Size
50 uL
Gene Name
ATR
Gene Alias
FRP1|MEC1|SCKL|SCKL1
Gene Description
ataxia telangiectasia and Rad3 related
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGWTPYM
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATR (NP_001175, 2545 a.a. ~ 2644 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
545
Enviar uma mensagem
ATR polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*