Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ATP7B monoclonal antibody (M02), clone 3A12
Abnova
ATP7B monoclonal antibody (M02), clone 3A12
Ref: AB-H00000540-M02
ATP7B monoclonal antibody (M02), clone 3A12
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ATP7B.
Información adicional
Size
100 ug
Gene Name
ATP7B
Gene Alias
PWD|WC1|WD|WND
Gene Description
ATPase, Cu++ transporting, beta polypeptide
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATP7B (NP_000044, 1372 a.a. ~ 1465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
540
Clone Number
3A12
Iso type
IgG1 Kappa
Enviar uma mensagem
ATP7B monoclonal antibody (M02), clone 3A12
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*