Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ATP6V1B2 purified MaxPab rabbit polyclonal antibody (D01P)
Abnova
ATP6V1B2 purified MaxPab rabbit polyclonal antibody (D01P)
Ref: AB-H00000526-D01P
ATP6V1B2 purified MaxPab rabbit polyclonal antibody (D01P)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human ATP6V1B2 protein.
Información adicional
Size
100 ug
Gene Name
ATP6V1B2
Gene Alias
ATP6B1B2|ATP6B2|HO57|VATB|VPP3|Vma2
Gene Description
ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MALRAMRGIVNGAAPELPVPTGGPAVGAQEQALAVSRNYLSQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILRTPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIRTGISAIDGMNSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMETARFFKSDFEENGSMD
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ATP6V1B2 (AAH30640.1, 1 a.a. ~ 511 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
526
Enviar uma mensagem
ATP6V1B2 purified MaxPab rabbit polyclonal antibody (D01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*