ATP5J monoclonal antibody (M09), clone 1F2
  • ATP5J monoclonal antibody (M09), clone 1F2

ATP5J monoclonal antibody (M09), clone 1F2

Ref: AB-H00000522-M09
ATP5J monoclonal antibody (M09), clone 1F2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant ATP5J.
Información adicional
Size 100 ug
Gene Name ATP5J
Gene Alias ATP5|ATP5A|ATPM|CF6|F6
Gene Description ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP5J (AAH01178, 1 a.a. ~ 108 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 522
Clone Number 1F2
Iso type IgG2a Kappa

Enviar uma mensagem


ATP5J monoclonal antibody (M09), clone 1F2

ATP5J monoclonal antibody (M09), clone 1F2