ATP5B purified MaxPab rabbit polyclonal antibody (D01P)
  • ATP5B purified MaxPab rabbit polyclonal antibody (D01P)

ATP5B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000506-D01P
ATP5B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ATP5B protein.
Información adicional
Size 100 ug
Gene Name ATP5B
Gene Alias ATPMB|ATPSB|MGC5231
Gene Description ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATP5B (NP_001677.2, 1 a.a. ~ 529 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 506

Enviar uma mensagem


ATP5B purified MaxPab rabbit polyclonal antibody (D01P)

ATP5B purified MaxPab rabbit polyclonal antibody (D01P)