Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ATP2B4 monoclonal antibody (M07), clone 2G8
Abnova
ATP2B4 monoclonal antibody (M07), clone 2G8
Ref: AB-H00000493-M07
ATP2B4 monoclonal antibody (M07), clone 2G8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ATP2B4.
Información adicional
Size
100 ug
Gene Name
ATP2B4
Gene Alias
ATP2B2|DKFZp686G08106|DKFZp686M088|MXRA1|PMCA4|PMCA4b|PMCA4x
Gene Description
ATPase, Ca++ transporting, plasma membrane 4
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATP2B4 (NP_001675, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
493
Clone Number
2G8
Iso type
IgG1 Kappa
Enviar uma mensagem
ATP2B4 monoclonal antibody (M07), clone 2G8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*