ATP2A3 monoclonal antibody (M01), clone 2H3
  • ATP2A3 monoclonal antibody (M01), clone 2H3

ATP2A3 monoclonal antibody (M01), clone 2H3

Ref: AB-H00000489-M01
ATP2A3 monoclonal antibody (M01), clone 2H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATP2A3.
Información adicional
Size 100 ug
Gene Name ATP2A3
Gene Alias SERCA3
Gene Description ATPase, Ca++ transporting, ubiquitous
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP2A3 (AAH35729, 501 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 489
Clone Number 2H3
Iso type IgG2a Kappa

Enviar uma mensagem


ATP2A3 monoclonal antibody (M01), clone 2H3

ATP2A3 monoclonal antibody (M01), clone 2H3