Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ATP2A1 monoclonal antibody (M07A), clone 2C9
Abnova
ATP2A1 monoclonal antibody (M07A), clone 2C9
Ref: AB-H00000487-M07A
ATP2A1 monoclonal antibody (M07A), clone 2C9
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ATP2A1.
Información adicional
Size
200 uL
Gene Name
ATP2A1
Gene Alias
ATP2A|SERCA1
Gene Description
ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA
Immunogen Prot. Seq
IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In ascites fluid
Gene ID
487
Clone Number
2C9
Iso type
IgG3 Kappa
Enviar uma mensagem
ATP2A1 monoclonal antibody (M07A), clone 2C9
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*