ATP2A1 monoclonal antibody (M03), clone 2C7
  • ATP2A1 monoclonal antibody (M03), clone 2C7

ATP2A1 monoclonal antibody (M03), clone 2C7

Ref: AB-H00000487-M03
ATP2A1 monoclonal antibody (M03), clone 2C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATP2A1.
Información adicional
Size 100 ug
Gene Name ATP2A1
Gene Alias ATP2A|SERCA1
Gene Description ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 487
Clone Number 2C7
Iso type IgG1 Kappa

Enviar uma mensagem


ATP2A1 monoclonal antibody (M03), clone 2C7

ATP2A1 monoclonal antibody (M03), clone 2C7