Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
FXYD2 monoclonal antibody (M01), clone 1C3-B3
Abnova
FXYD2 monoclonal antibody (M01), clone 1C3-B3
Ref: AB-H00000486-M01
FXYD2 monoclonal antibody (M01), clone 1C3-B3
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a full length recombinant FXYD2.
Información adicional
Size
100 ug
Gene Name
FXYD2
Gene Alias
ATP1G1|HOMG2|MGC12372
Gene Description
FXYD domain containing ion transport regulator 2
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq
MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
FXYD2 (AAH05302.1, 1 a.a. ~ 64 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
486
Clone Number
1C3-B3
Iso type
IgG2b kappa
Enviar uma mensagem
FXYD2 monoclonal antibody (M01), clone 1C3-B3
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*