ATP1B3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ATP1B3 purified MaxPab rabbit polyclonal antibody (D01P)

ATP1B3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000483-D01P
ATP1B3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ATP1B3 protein.
Información adicional
Size 100 ug
Gene Name ATP1B3
Gene Alias ATPB-3|CD298|FLJ29027
Gene Description ATPase, Na+/K+ transporting, beta 3 polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 483

Enviar uma mensagem


ATP1B3 purified MaxPab rabbit polyclonal antibody (D01P)

ATP1B3 purified MaxPab rabbit polyclonal antibody (D01P)