Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ATOX1 monoclonal antibody (M04), clone 3G11
Abnova
ATOX1 monoclonal antibody (M04), clone 3G11
Ref: AB-H00000475-M04
ATOX1 monoclonal antibody (M04), clone 3G11
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ATOX1.
Información adicional
Size
100 ug
Gene Name
ATOX1
Gene Alias
ATX1|HAH1|MGC138453|MGC138455
Gene Description
ATX1 antioxidant protein 1 homolog (yeast)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
475
Clone Number
3G11
Iso type
IgG
Enviar uma mensagem
ATOX1 monoclonal antibody (M04), clone 3G11
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*