ATF3 MaxPab mouse polyclonal antibody (B01P)
  • ATF3 MaxPab mouse polyclonal antibody (B01P)

ATF3 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000467-B01P
ATF3 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ATF3 protein.
Información adicional
Size 50 ug
Gene Name ATF3
Gene Alias -
Gene Description activating transcription factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ATF3 (NP_001665.1, 1 a.a. ~ 181 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 467

Enviar uma mensagem


ATF3 MaxPab mouse polyclonal antibody (B01P)

ATF3 MaxPab mouse polyclonal antibody (B01P)