Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ASS1 monoclonal antibody (M02), clone 2D2
Abnova
ASS1 monoclonal antibody (M02), clone 2D2
Ref: AB-H00000445-M02
ASS1 monoclonal antibody (M02), clone 2D2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ASS1.
Información adicional
Size
100 ug
Gene Name
ASS1
Gene Alias
ASS|CTLN1
Gene Description
argininosuccinate synthetase 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA,IF
Immunogen Prot. Seq
KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ASS1 (NP_000041.2, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
445
Clone Number
2D2
Iso type
IgG2a Kappa
Enviar uma mensagem
ASS1 monoclonal antibody (M02), clone 2D2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*