ASPA MaxPab rabbit polyclonal antibody (D01)
  • ASPA MaxPab rabbit polyclonal antibody (D01)

ASPA MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00000443-D01
ASPA MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ASPA protein.
Información adicional
Size 100 uL
Gene Name ASPA
Gene Alias ACY2|ASP
Gene Description aspartoacylase (Canavan disease)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASPA (NP_000040.1, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 443

Enviar uma mensagem


ASPA MaxPab rabbit polyclonal antibody (D01)

ASPA MaxPab rabbit polyclonal antibody (D01)