ASNS purified MaxPab rabbit polyclonal antibody (D01P)
  • ASNS purified MaxPab rabbit polyclonal antibody (D01P)

ASNS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000440-D01P
ASNS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ASNS protein.
Información adicional
Size 100 ug
Gene Name ASNS
Gene Alias TS11
Gene Description asparagine synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDEPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ASNS (NP_001664.2, 1 a.a. ~ 561 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 440

Enviar uma mensagem


ASNS purified MaxPab rabbit polyclonal antibody (D01P)

ASNS purified MaxPab rabbit polyclonal antibody (D01P)